You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb579650 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CTH |
| Target | CTH |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CTH |
| Protein Sequence | Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF |
| UniProt ID | P32929 |
| MW | 45 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | MGC9471 |
| Note | For research use only |
| NCBI | NP_001893 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 45 kDa, 41 kDa and 39 kDa.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Type: Human K562 cell lysate, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human liver (LI), Negative control (-): 293T (2T), Antibody concentration: 3 ug/ml.

WB Suggested Anti-CTH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.
FC, WB | |
Bovine, Canine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Equine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review