CTH Rabbit Polyclonal Antibody

• Catalog Number: orb579650
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CTH
• Target: CTH
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CTH
• Protein Sequence: Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF
• UniProt ID: P32929
• MW: 45 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MGC9471
• Note: For research use only
• NCBI: NP_001893

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 45 kDa, 41 kDa and 39 kDa.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Type: Human K562 cell lysate, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human liver (LI), Negative control (-): 293T (2T), Antibody concentration: 3 ug/ml.

WB Suggested Anti-CTH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.