CTDSPL Rabbit Polyclonal Antibody

• Catalog Number: orb330230
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CTDSPL
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Mouse, Porcine, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CTDSPL
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 30kDa
• Target: CTDSPL
• UniProt ID: Q3ZTU0
• Protein Sequence: Synthetic peptide located within the following region: CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC
• NCBI: NP_005799
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti C3orf8 antibody, anti HYA22 antibody, anti PS
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-CTDSPL Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-CTDSPL Antibody Titration: 0.2-1 ug/mL, Positive Control: DLD1 cell lysate, CTDSPL is strongly supported by BioGPS gene expression data to be expressed in Human DLD1 cells.