You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329762 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CSRP3 |
Target | CSRP3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CSRP3 |
Protein Sequence | Synthetic peptide located within the following region: QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCG |
UniProt ID | P50461 |
MW | 21kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CLP antibody, anti MLP antibody, anti CRP3 an Read more... |
Note | For research use only |
NCBI | NP_003467 |
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-CSRP3 Antibody, Titration: 2.5 ug/mL, Positive Control: Fetal heart.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |