CSRP3 Rabbit Polyclonal Antibody

• Catalog Number: orb329762
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CSRP3
• Target: CSRP3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CSRP3
• Protein Sequence: Synthetic peptide located within the following region: QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCG
• UniProt ID: P50461
• MW: 21kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CLP antibody, anti MLP antibody, anti CRP3 an
• Research Area: Cardiovascular Research, Epigenetics & Chromatin,
• Note: For research use only
• NCBI: NP_003467
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-CSRP3 Antibody, Titration: 2.5 ug/mL, Positive Control: Fetal heart.