You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581689 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CRY2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CRY2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 67kDa |
Target | CRY2 |
UniProt ID | Q49AN0 |
Protein Sequence | Synthetic peptide located within the following region: IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE |
NCBI | NP_066940 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HCRY2, PHLL2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human RPMI 8226 Whole Cell, Antibody dilution: 1 ug/ml.
Positive control (+): Human Placenta (PL), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 1 ug/ml.
Rabbit Anti-CRY2 Antibody, Catalog Number: orb581689, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-CRY2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: U937 cell lysate.
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |