CRNN Rabbit Polyclonal Antibody

• Catalog Number: orb325015
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CRNN
• Target: CRNN
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CRNN
• Protein Sequence: Synthetic peptide located within the following region: GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG
• UniProt ID: Q9UBG3
• MW: 54 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti C1orf10 antibody, anti PDRC1 antibody, anti S
• Research Area: Disease Biomarkers
• Note: For research use only
• NCBI: NP_057274

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Positive control (+): Human Fetal Heart (HE), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 1 ug/mL.

WB Suggested Anti-CRNN Antibody, Titration: 1.0 ug/mL, Positive Control: HT1080 Whole Cell.