You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325015 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CRNN |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Equine |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CRNN |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 54 kDa |
Target | CRNN |
UniProt ID | Q9UBG3 |
Protein Sequence | Synthetic peptide located within the following region: GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG |
NCBI | NP_057274 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti C1orf10 antibody, anti PDRC1 antibody, anti S Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
Positive control (+): Human Fetal Heart (HE), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 1 ug/mL.
WB Suggested Anti-CRNN Antibody, Titration: 1.0 ug/mL, Positive Control: HT1080 Whole Cell.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Human | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Canine, Equine, Human | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Canine, Equine, Human | |
Rabbit | |
Polyclonal | |
Biotin |