CRLS1 Rabbit Polyclonal Antibody

• Catalog Number: orb580737
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CRLS1
• Target: CRLS1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CRLS1
• Protein Sequence: Synthetic peptide located within the following region: WTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARN
• UniProt ID: Q9UJA2
• MW: 33 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CLS, CLS1, GCD10, C20orf155, dJ967N21.6
• Research Area: Cell Biology, Signal Transduction, Stem Cell & Dev
• Note: For research use only
• NCBI: NP_061968

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. 33 kDa and 23 kDa isoforms contain the peptide sequence.

Rabbit Anti-CRLS1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Heart, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-CRLS1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Tonsil, Skeletal Myocytes, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-CRLS1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.