CRISPLD2 Rabbit Polyclonal Antibody

• Catalog Number: orb580945
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CRISPLD2
• Target: CRISPLD2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRISPLD2
• Protein Sequence: Synthetic peptide located within the following region: MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA
• UniProt ID: Q9H0B8
• MW: 56kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: LGL1, CRISP11, LCRISP2
• Research Area: Cell Biology, Signal Transduction
• Note: For research use only
• NCBI: NP_113664

Sample Type: 1. Human Lung Fibroblast cells (40 ug), 2. Mouse lung cells (40 ug), Primary dilution: 1:2000, Secondary Antibody: Anti-rabbit IgG horseradish peroxidase, Secondary dilution: 1:1000.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms containing the peptide sequence are present at ~51 and ~42 kDa.

CRISPLD2 antibody - N-terminal region (orb580945) validated by WB using human and mouse serum, human fetal lung cell culture at 0.5 ug/ml.

CRISPLD2 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb580945 with 1:200 dilution. Western blot was performed using orb580945 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: CRISPLD2 IP with orb580945 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-CRISPLD2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.