CRISPLD1 Rabbit Polyclonal Antibody

• Catalog Number: orb326444
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CRISPLD1
• Target: CRISPLD1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: YSPKGNWWGHAPYKHGRPCSACPPSFGGGCRENLCYKEGSDRYYPPREEE
• UniProt ID: Q9H336
• MW: 55kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CRISP10 antibody, anti DKFZp762F133 antibody,
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_113649

Positive control (+): Human Liver (LI), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 1 ug/mL.

WB Suggested Anti-CRISPLD1 Antibody, Titration: 1.0 ug/mL, Positive Control: Fetal Liver.