You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585710 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CRHR1 |
Target | CRHR1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: RPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKA |
UniProt ID | P34998 |
MW | 44kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CRF1, CRHR, CRF-R, CRFR1, CRF-R1, CRFR-1, CRH-R1, Read more... |
Note | For research use only |
NCBI | NP_001138620 |
Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.
WB Suggested Anti-CRHR1 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell.
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |