CREBBP Rabbit Polyclonal Antibody

• Catalog Number: orb578887
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CREBBP
• Target: CREBBP
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CREBBP
• Protein Sequence: Synthetic peptide located within the following region: TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS
• UniProt ID: Q4LE28
• MW: 261kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CBP, RSTS, KAT3A, MKHK1, RSTS1
• Research Area: Cancer Biology, Cell Biology, Epigenetics & Chroma
• Note: For research use only
• NCBI: NP_001073315
• Expiration Date: 12 months from date of receipt.

Anti-CREBBP antibody IHC staining of human breast. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Positive control (+): Human Lung Tumor (T-LU), Negative control (-): Human Liver Tumor (T-LI), Antibody concentration: 0.25 ug/ml.

Rabbit Anti-CREBBP Antibody, Paraffin Embedded Tissue: Human Colon, Antibody Concentration: 5 ug/ml.

WB Suggested Anti-CREBBP Antibody Titration: 1 ug/ml, Positive Control: Jurkat cell lysate.