You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578887 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CREBBP |
Target | CREBBP |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CREBBP |
Protein Sequence | Synthetic peptide located within the following region: TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS |
UniProt ID | Q4LE28 |
MW | 261kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CBP, RSTS, KAT3A, MKHK1, RSTS1 |
Note | For research use only |
NCBI | NP_001073315 |
Anti-CREBBP antibody IHC staining of human breast. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Positive control (+): Human Lung Tumor (T-LU), Negative control (-): Human Liver Tumor (T-LI), Antibody concentration: 0.25 ug/ml.
Rabbit Anti-CREBBP Antibody, Paraffin Embedded Tissue: Human Colon, Antibody Concentration: 5 ug/ml.
WB Suggested Anti-CREBBP Antibody Titration: 1 ug/ml, Positive Control: Jurkat cell lysate.
IF, IHC-Fr, IHC-P | |
Canine, Equine, Gallus, Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |