You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583354 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CRBN |
Target | CRBN |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CRBN |
Protein Sequence | Synthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL |
UniProt ID | Q96SW2 |
MW | 50 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | MRT2, MRT2A |
Note | For research use only |
NCBI | NP_057386 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human DLD1 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human HCT15, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Human Liver Tumor, Antibody dilution: 1 ug/ml.
Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.
Sample Type: RPMI-8226 Whole cell lysates, Antibody dilution: 0.5 ug/ml.
Positive control (+): HepG2 (HG), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.
WB Suggested Anti-CRBN Antibody Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Porcine, Rabbit, Sheep, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Gallus, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Porcine, Rabbit, Sheep, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PerCP/Cy5.5 |