CPXCR1 Rabbit Polyclonal Antibody

• Catalog Number: orb577268
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CPXCR1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPXCR1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: CPXCR1
• UniProt ID: Q8N123
• Protein Sequence: Synthetic peptide located within the following region: WANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIV
• NCBI: NP_149037
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CT77
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Anti-CPXCR1 antibody IHC staining of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.

Anti-CPXCR1 antibody IHC staining of human thymus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.

Rabbit Anti-CPXCR1 Antibody, Paraffin Embedded Tissue: Human Tymus, Antibody Concentration: 10 ug/ml.

WB Suggested Anti-CPXCR1 Antibody Titration: 1 ug/ml, Positive Control: Fetal Brain Lysate.