CPT1B antibody

• Catalog Number: orb330486
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CPT1B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPT1B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 88 kDa
• Target: CPT1B
• UniProt ID: Q92523
• Protein Sequence: Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
• NCBI: NP_004368
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CPT1-M antibody, anti KIAA1670 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Capan1 tissue using CPT1B antibody

Western blot analysis of human Capan1 tissue using CPT1B antibody

Western blot analysis of HT1080 cell lysate tissue using CPT1B antibody