CPT1B Rabbit Polyclonal Antibody

• Catalog Number: orb330486
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CPT1B
• Target: CPT1B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPT1B
• Protein Sequence: Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA
• UniProt ID: Q92523
• MW: 88 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CPT1-M antibody, anti KIAA1670 antibody, anti
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_004368

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

Positive control (+): Hela (HL), Negative control (-): Human liver (LI), Antibody concentration: 0.5 ug/mL.

Application: IHC, Species+tissue/cell type: Species+tissue/cell type: Human Capan1 cells, Primary antibody Dilution: 1:300, Secondary antibody: Anti-rabbit Alexa Fluor 488, Secondary antibody Dilution: 1:200.

Sample Type: 1: 45 ug human capan1 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: CPT1B.

WB Suggested Anti-CPT1B Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HT1080 cell lysate, CPT1B is supported by BioGPS gene expression data to be expressed in HT1080.