You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330486 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CPT1B |
| Target | CPT1B |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CPT1B |
| Protein Sequence | Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA |
| UniProt ID | Q92523 |
| MW | 88 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti CPT1-M antibody, anti KIAA1670 antibody, anti Read more... |
| Research Area | Cell Biology |
| Note | For research use only |
| NCBI | NP_004368 |

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

Positive control (+): Hela (HL), Negative control (-): Human liver (LI), Antibody concentration: 0.5 ug/mL.

Application: IHC, Species+tissue/cell type: Species+tissue/cell type: Human Capan1 cells, Primary antibody Dilution: 1:300, Secondary antibody: Anti-rabbit Alexa Fluor 488, Secondary antibody Dilution: 1:200.

Sample Type: 1: 45 ug human capan1 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: CPT1B.

WB Suggested Anti-CPT1B Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HT1080 cell lysate, CPT1B is supported by BioGPS gene expression data to be expressed in HT1080.
FC | |
Bovine, Canine, Equine, Mouse, Porcine, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review