CPSF6 Rabbit Polyclonal Antibody

• Catalog Number: orb577736
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CPSF6
• Target: CPSF6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPSF6
• Protein Sequence: Synthetic peptide located within the following region: PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP
• UniProt ID: Q16630
• MW: 61kDa
• Tested applications: IF, IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CFIM, CFIM68, CFIM72, HPBRII-4, HPBRII-7
• Research Area: Molecular Biology
• Note: For research use only
• NCBI: NP_008938
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-CPSF6 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 16.0 ug/ml, Magnification: 400X.

Sample Type: SKOV3, Primary Antibody Dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody Dilution: 2 ug/ml, Gene Name: CPSF6.

WB Suggested Anti-CPSF6 Antibody Titration: 0.3125 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate. CPSF6 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.