Cart summary

You have no items in your shopping cart.

CPSF4 Rabbit Polyclonal Antibody (HRP)

CPSF4 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2125079

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2125079
CategoryAntibodies
DescriptionCPSF4 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CPSF4
Protein SequenceSynthetic peptide located within the following region: SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK
UniProt IDO95639
MW24kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesNAR, NEB1, NEB-1, CPSF30
NoteFor research use only
NCBIEAW76662
  • CPSF4 Rabbit Polyclonal Antibody (HRP) [orb479937]

    IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    HRP

    100 μl