CPS1 Rabbit Polyclonal Antibody

• Catalog Number: orb579542
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CPS1
• Target: CPS1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Porcine
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPS1
• Protein Sequence: Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI
• UniProt ID: P31327
• MW: 165kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PHN, CPSASE1
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_001866

Human Intestine

Sample Type: Pig duodenum, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-biotin, streptavidin-HRP, Secondary Antibody dilution: 1:500, Color/Signal Descriptions: Brown: CPS, Gene Name: CPS1.

Sample Type: Pig ileum, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-biotin, streptavidin-HRP, Secondary Antibody dilution: 1:500, Color/Signal Descriptions: Brown: CPS, Gene Name: CPS1.

Sample Type: Pig kidney, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-biotin, streptavidin-HRP, Secondary Antibody dilution: 1:500, Color/Signal Descriptions: Brown: CPS, Gene Name: CPS1.

WB Suggested Anti-CPS1 Antibody Titration: 5.0 ug/ml, Positive Control: Fetal liver cell lysate.