Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CPE Rabbit Polyclonal Antibody

SKU: orb583996

Description

CPE Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CPE. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human CPE. This antibody reacts with Human samples and is predicted to react with Bovine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Neuroscience, Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CPE
TargetCPE
Protein SequenceSynthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
Molecular Weight52kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CPH

Similar Products

  • CPEB4 Rabbit Polyclonal Antibody [orb577870]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Claudin 3/CLDN3 Rabbit Polyclonal Antibody [orb745940]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Claudin-3 rabbit pAb Antibody [orb764862]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CPE rabbit pAb Antibody [orb764914]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Claudin 3 Rabbit Polyclonal Antibody [orb5878]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Human, Mouse, Porcine, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CPE Rabbit Polyclonal Antibody

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. CPE is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

CPE Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

CPE Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

CPE Rabbit Polyclonal Antibody

Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5 ug/ml using anti-CPE antibody (orb583996).

CPE Rabbit Polyclonal Antibody

Rabbit Anti-CPE Antibody, Catalog Number: orb583996, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

CPE Rabbit Polyclonal Antibody

WB Suggested Anti-CPE Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate. CPE is supported by BioGPS gene expression data to be expressed in MCF7.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001864

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

CPE Rabbit Polyclonal Antibody (orb583996)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry