Cart summary

You have no items in your shopping cart.

COX4I1 Rabbit Polyclonal Antibody

SKU: orb330257

Description

Rabbit polyclonal antibody to COX4I1

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human COX4I1
TargetCOX4I1
Protein SequenceSynthetic peptide located within the following region: AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK
Molecular Weight19kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti COX4 antibody, anti COXIV antibody, anti MGC72016 antibody, anti COX4-1 antibody

Similar Products

  • COX IV/COX4I1 Rabbit Polyclonal Antibody [orb412995]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • COX IV/COX4I1 Rabbit Polyclonal Antibody [orb1145826]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • COX4I1 Rabbit Polyclonal Antibody [orb182884]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • COX4I1 Rabbit Polyclonal Antibody [orb10451]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • COX4I1 Antibody [orb625983]

    ELISA,  FC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

COX4I1 Rabbit Polyclonal Antibody

COX4I1 antibody - N-terminal region (orb330257) validated by WB using 1. Human liver, 2. Rat liver, 3. Wild-type mouse liver, 4. AMPKa1+2-/- mouse liver, 5. Human muscle, 6. Rat muscle, 7. Mouse muscle at 1:1000.

COX4I1 Rabbit Polyclonal Antibody

COX4I1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb330257 with 1:200 dilution. Western blot was performed using orb330257 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: COX4I1 IP with orb330257 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

COX4I1 Rabbit Polyclonal Antibody

Human Heart

COX4I1 Rabbit Polyclonal Antibody

Human kidney

COX4I1 Rabbit Polyclonal Antibody

Lanes: Lane 1: 50 ug HeLa lysate, Lane 2: 50 ug 293T lysate, Lane 3: 50 ug K562 lysate, Lane 4: 50 ug MDA-MB-231 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Gene Name: COX4I1.

COX4I1 Rabbit Polyclonal Antibody

Rabbit Anti-COX4I1 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

COX4I1 Rabbit Polyclonal Antibody

WB Suggested Anti-COX4I1 Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate, COX4I1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001852

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

COX4I1 Rabbit Polyclonal Antibody (orb330257)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 530.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry