You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330257 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to COX4I1 |
Target | COX4I1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human COX4I1 |
Protein Sequence | Synthetic peptide located within the following region: AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK |
UniProt ID | P13073 |
MW | 19kDa |
Tested applications | IHC-P, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti COX4 antibody, anti COXIV antibody, anti MGC7 Read more... |
Note | For research use only |
NCBI | NP_001852 |
Expiration Date | 12 months from date of receipt. |
COX4I1 antibody - N-terminal region (orb330257) validated by WB using 1. Human liver, 2. Rat liver, 3. Wild-type mouse liver, 4. AMPKa1+2-/- mouse liver, 5. Human muscle, 6. Rat muscle, 7. Mouse muscle at 1:1000.
COX4I1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb330257 with 1:200 dilution. Western blot was performed using orb330257 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: COX4I1 IP with orb330257 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
Human Heart
Human kidney
Lanes: Lane 1: 50 ug HeLa lysate, Lane 2: 50 ug 293T lysate, Lane 3: 50 ug K562 lysate, Lane 4: 50 ug MDA-MB-231 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Gene Name: COX4I1.
Rabbit Anti-COX4I1 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
WB Suggested Anti-COX4I1 Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate, COX4I1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |