COX15 Rabbit Polyclonal Antibody

• Catalog Number: orb579790
• Category: Antibodies
• Description: Rabbit polyclonal antibody to COX15
• Target: COX15
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COX15
• Protein Sequence: Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
• UniProt ID: Q7KZN9
• MW: 46 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MC4DN6, CEMCOX2
• Note: For research use only
• NCBI: NP_004367

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Lanes: Lane 1: 20 ug human fibroblast mitochondria, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: COX15.

Rabbit Anti-COX15 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-COX15 Antibody Titration: 5.0 ug/ml, Positive Control: HepG2 cell lysate. COX15 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.