COQ9 Rabbit Polyclonal Antibody

• Catalog Number: orb585618
• Category: Antibodies
• Description: Rabbit polyclonal antibody to COQ9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: COQ9
• UniProt ID: O75208
• Protein Sequence: Synthetic peptide located within the following region: ASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGE
• NCBI: NP_064708
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: COQ10D5, C16orf49
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-COQ9 Antibody, Catalog Number: orb585618, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-COQ9 Antibody, Titration: 1.0 ug/ml, Positive Control: HCT15 Whole Cell. COQ9 is supported by BioGPS gene expression data to be expressed in HCT15.