You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb580599 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Coq5 |
| Target | Coq5 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Protein Sequence | Synthetic peptide located within the following region: RSLSQEKRAAETHFGFETVSEKEKGGKVYQVFQSVARKYDLMNDMMSLGI |
| UniProt ID | Q4G064 |
| MW | 35kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | RGD1310857 |
| Note | For research use only |
| NCBI | NP_001034111 |

WB Suggested Anti-Coq5 Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Lung.
ICC, IF | |
Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
RBITC |
ICC, IF | |
Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy7 |
ICC, IF | |
Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
PE |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review