COQ2 Rabbit Polyclonal Antibody

• Catalog Number: orb579975
• Category: Antibodies
• Description: Rabbit polyclonal antibody to COQ2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human COQ2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42kDa
• Target: COQ2
• UniProt ID: Q96H96
• Protein Sequence: Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
• NCBI: NP_056512
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MSA1, CL640, COQ10D1, PHB:PPT
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human MCF7, Antibody dilution: 1.0 ug/ml.

Positive control (+): MCF7 (N10), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.

WB Suggested Anti-COQ2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: DU145 cell lysate. COQ2 is supported by BioGPS gene expression data to be expressed in DU145.