You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579975 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to COQ2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human COQ2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 42kDa |
Target | COQ2 |
UniProt ID | Q96H96 |
Protein Sequence | Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML |
NCBI | NP_056512 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MSA1, CL640, COQ10D1, PHB:PPT Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human MCF7, Antibody dilution: 1.0 ug/ml.
Positive control (+): MCF7 (N10), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.
WB Suggested Anti-COQ2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: DU145 cell lysate. COQ2 is supported by BioGPS gene expression data to be expressed in DU145.
WB | |
Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-Fr, IHC-P, WB | |
Bovine, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
HRP |