COPG Rabbit Polyclonal Antibody

• Catalog Number: orb582719
• Category: Antibodies
• Description: Rabbit polyclonal antibody to COPG
• Target: COPG1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COPG
• Protein Sequence: Synthetic peptide located within the following region: MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK
• UniProt ID: Q9Y678
• MW: 98kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: COPG
• Note: For research use only
• NCBI: NP_057212
• Expiration Date: 12 months from date of receipt.

COPG1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb582719 with 1:200 dilution. Western blot was performed using orb582719 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: COPG1 IP with orb582719 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-COPG Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: THP-1 cell lysate.