COPA Rabbit Polyclonal Antibody

• Catalog Number: orb325700
• Category: Antibodies
• Description: Rabbit polyclonal antibody to COPA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COPA
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 138 kDa
• Target: COPA
• UniProt ID: P53621
• Protein Sequence: Synthetic peptide located within the following region: PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD
• NCBI: NP_004362
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ26320 antibody, anti HEP-COP antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/mL.

Sample Type: Hela Whole Cell lysates, Antibody Dilution: 3.0 ug/mL.

Sample Type: Hela Whole Cell lysates, Antibody Dilution: 3 ug/mL.

Positive control (+): Hela (HL), Negative control (-): Human heart (HE), Antibody concentration: 1 ug/mL.

WB Suggested Anti-COPA Antibody Titration: 0.2-1 ug/mL, Positive Control: Hela cell lysate, COPA is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.