COPA antibody

• Catalog Number: orb325700
• Category: Antibodies
• Description: Rabbit polyclonal antibody to COPA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COPA
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 138 kDa
• Target: COPA
• UniProt ID: P53621
• Protein Sequence: Synthetic peptide located within the following region: PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD
• NCBI: NP_004362
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ26320 antibody, anti HEP-COP antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Hela cell lysate tissue using COPA antibody

Western blot analysis of human Hela Whole Cell tissue using COPA antibody

Western blot analysis of human Hela Whole Cell tissue using COPA antibody