You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326635 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to COL6A5 |
Target | COL6A5 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human COL6A5 |
Protein Sequence | Synthetic peptide located within the following region: RNVSLRAKCQGYSIFVFSFGPKHNDKELEELASHPLDHHLVQLGRTHKPD |
UniProt ID | A8TX70 |
MW | 62kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti COL6A5 antibody, anti FLJ35880 antibody, anti Read more... |
Note | For research use only |
NCBI | NP_694996 |
Sample Type: Fetal Heart lysates, Antibody Dilution: 1.0 ug/mL.
Positive control (+): Human Lung (LU), Negative control (-): Human Placenta (PL), Antibody concentration: 1 ug/mL.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
IF, IHC-Fr, IHC-P | |
Human | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |