COL4A3BP Rabbit Polyclonal Antibody

• Catalog Number: orb581695
• Category: Antibodies
• Description: Rabbit polyclonal antibody to COL4A3BP
• Target: COL4A3BP
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COL4A3BP
• Protein Sequence: Synthetic peptide located within the following region: PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL
• UniProt ID: Q9Y5P4
• MW: 68kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CERT, GPBP, CERTL, MRD34, STARD11, COL4A3BP
• Note: For research use only
• NCBI: NP_112729

COL4A3BP was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb581695 with 1:200 dilution. Western blot was performed using orb581695 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: COL4A3BP IP with orb581695 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-COL4A3BP Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.