You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581695 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to COL4A3BP |
Target | COL4A3BP |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human COL4A3BP |
Protein Sequence | Synthetic peptide located within the following region: PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL |
UniProt ID | Q9Y5P4 |
MW | 68kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CERT, GPBP, CERTL, MRD34, STARD11, COL4A3BP |
Note | For research use only |
NCBI | NP_112729 |
COL4A3BP was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb581695 with 1:200 dilution. Western blot was performed using orb581695 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: COL4A3BP IP with orb581695 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
WB Suggested Anti-COL4A3BP Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
IF, IHC-Fr, IHC-P | |
Bovine, Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P, WB | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
FITC |
IF | |
Bovine, Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
PE/Cy5 |