Cart summary

You have no items in your shopping cart.

COL27A1 Rabbit Polyclonal Antibody (FITC)

COL27A1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2097891

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2097891
CategoryAntibodies
DescriptionCOL27A1 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human COL27A1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW90kDa
UniProt IDQ8IZC6
Protein SequenceSynthetic peptide located within the following region: LPGPKGDKGSRGDWGLQGPRGPPGPRGRPGPPGPPGGPIQLQQDDLGAAF
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesSTLS
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.