You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576713 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Cnot8 |
Target | Cnot8 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: VWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQL |
UniProt ID | Q9D8X5 |
MW | 33kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | AA536816, AU015770, AU043059, 1500015I04Rik, 18100 Read more... |
Note | For research use only |
NCBI | NP_081225 |
Antibody Dilution: 1.0 ug/ml, Sample Type: Mouse Testis.
FC, IF, IHC-P, WB | |
Mouse | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |