CNOT7 Rabbit Polyclonal Antibody

• Catalog Number: orb576939
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CNOT7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CNOT7
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 30kDa
• Target: CNOT7
• UniProt ID: Q9UIV1
• Protein Sequence: Synthetic peptide located within the following region: TEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPP
• NCBI: NP_037486
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CAF1, CAF-1, Caf1a, hCAF-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-CNOT7 antibody, Paraffin Embedded Tissue: Human Heart, cell Cellular Data: cardiac cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

WB Suggested Anti-CNOT7 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. CNOT7 is supported by BioGPS gene expression data to be expressed in HepG2.