CNBP Rabbit Polyclonal Antibody

• Catalog Number: orb575277
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CNBP
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CNBP
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 19 kDa
• Target: CNBP
• UniProt ID: P62633
• Protein Sequence: Synthetic peptide located within the following region: SSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLP
• NCBI: NP_003409
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DM2, ZNF9, CNBP1, PROMM, RNF163, ZCCHC22
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

CNBP antibody - N-terminal region (orb575277) validated by WB using human primary myoblasts at 1:1000.

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-CNBP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: Human brain.