MTCP1NB Rabbit Polyclonal Antibody

• Catalog Number: orb324369
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CMC4
• Target: CMC4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: KCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKS
• UniProt ID: P56277
• MW: 8kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti C6.1B antibody, anti MGC2069 antibody, anti M
• Research Area: Cell Biology, Immunology & Inflammation
• Note: For research use only
• NCBI: NP_001018024
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-MTCP1NB Antibody, Catalog Number: orb324369, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, strong signal resembling mitochondria staining, wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 â€" 2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-MTCP1NB Antibody, Titration: 1.0 ug/mL, Positive Control: 293T Whole Cell, CMC4 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.