You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324369 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CMC4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 8kDa |
Target | CMC4 |
UniProt ID | P56277 |
Protein Sequence | Synthetic peptide located within the following region: KCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKS |
NCBI | NP_001018024 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti C6.1B antibody, anti MGC2069 antibody, anti M Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-MTCP1NB Antibody, Catalog Number: orb324369, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, strong signal resembling mitochondria staining, wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 â€" 2.0 sec, Protocol located in Reviews and Data.
WB Suggested Anti-MTCP1NB Antibody, Titration: 1.0 ug/mL, Positive Control: 293T Whole Cell, CMC4 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
Filter by Rating