CLUH Rabbit Polyclonal Antibody

• Catalog Number: orb327010
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CLUH
• Target: CLUH
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CLUH
• Protein Sequence: Synthetic peptide located within the following region: SVFTDGDLGDSGKRKKGLEMDPIDCTPPEYILPGSRERPLCPLQPQNRDW
• UniProt ID: O75153
• MW: 147 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CLU1 antibody
• Note: For research use only
• NCBI: NP_056044

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 147 kDa isoform is identified.

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: 293T Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Liver Tumor (T-LI), Antibody concentration: 3 ug/mL.

KIAA0664 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb327010 with 1:200 dilution. Western blot was performed using orb327010 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: KIAA0664 IP with orb327010 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.