You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb327010 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CLUH |
Target | CLUH |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CLUH |
Protein Sequence | Synthetic peptide located within the following region: SVFTDGDLGDSGKRKKGLEMDPIDCTPPEYILPGSRERPLCPLQPQNRDW |
UniProt ID | O75153 |
MW | 147 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CLU1 antibody |
Note | For research use only |
NCBI | NP_056044 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 147 kDa isoform is identified.
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Sample Type: 293T Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.
Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Liver Tumor (T-LI), Antibody concentration: 3 ug/mL.
KIAA0664 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb327010 with 1:200 dilution. Western blot was performed using orb327010 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: KIAA0664 IP with orb327010 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
IF, IH, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |