Cart summary

You have no items in your shopping cart.

CLMN Rabbit Polyclonal Antibody (Biotin)

CLMN Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2107180

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2107180
CategoryAntibodies
DescriptionCLMN Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Human, Mouse, Porcine, Yeast
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CLMN
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW110kDa
UniProt IDQ96JQ2
Protein SequenceSynthetic peptide located within the following region: LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI
NCBINP_079010
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesFLJ12383, KIAA1188
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.