You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575358 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CLIC1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CLIC1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 27 kDa |
Target | CLIC1 |
UniProt ID | Q502X1 |
Protein Sequence | Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF |
NCBI | NP_001279 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | G6, CL1C1, NCC27, CLCNL1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.
Human kidney
Lanes: Lane 1: 30 ug mouse renal epithelial lysate, Lane 2: 30 ug mouse renal epithelial lysate, Lane 3: 30 ug mouse renal epithelial lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:2500, Gene Name: CLIC1.
Sample Type: Purified Recombinant CLIC-1 Protein Primary dilution: 1:1000.
WB Suggested Anti-CLIC1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |