CLIC1 Rabbit Polyclonal Antibody

• Catalog Number: orb575358
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CLIC1
• Target: CLIC1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CLIC1
• Protein Sequence: Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF
• UniProt ID: Q502X1
• MW: 27 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: G6, CL1C1, NCC27, CLCNL1
• Research Area: Cell Biology, Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_001279

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Human kidney

Lanes: Lane 1: 30 ug mouse renal epithelial lysate, Lane 2: 30 ug mouse renal epithelial lysate, Lane 3: 30 ug mouse renal epithelial lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:2500, Gene Name: CLIC1.

Sample Type: Purified Recombinant CLIC-1 Protein Primary dilution: 1:1000.

WB Suggested Anti-CLIC1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.