Cart summary

You have no items in your shopping cart.

CLEC4M Rabbit Polyclonal Antibody (HRP)

CLEC4M Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2122256

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2122256
CategoryAntibodies
DescriptionCLEC4M Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityHuman, Mouse, Porcine, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CLEC4M
Protein SequenceSynthetic peptide located within the following region: NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFS
UniProt IDQ9H2X3
MW45kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesCD299, LSIGN, CD209L, L-SIGN, DCSIGNR, HP10347, DC
Read more...
NoteFor research use only
NCBINP_055072