Cart summary

You have no items in your shopping cart.

Clec1b Rabbit Polyclonal Antibody (FITC)

Clec1b Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2115936

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2115936
CategoryAntibodies
DescriptionClec1b Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW26kDa
UniProt IDQ9JL99
Protein SequenceSynthetic peptide located within the following region: MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVAL
NCBINP_064369
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesClec, Clec-, Clec2, Clec-2, 1810061I13Rik
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.