CLDN23 Rabbit Polyclonal Antibody

• Catalog Number: orb574767
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CLDN23
• Target: CLDN23
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Mouse, Porcine, Rat, Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN23
• Protein Sequence: Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE
• UniProt ID: Q6ZW63
• MW: 17kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CLDNL, hCG1646163
• Research Area: Cell Biology, Infectious Disease & Virology
• Note: For research use only
• NCBI: NP_919260

Sample Tissue: Human A172 Whole Cell, Antibody dilution: 1 ug/ml.

Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-CLDN23 antibody (orb574767).

WB Suggested Anti-CLDN23 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.