You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb574767 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CLDN23 |
| Target | CLDN23 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Mouse, Porcine, Rat, Yeast |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN23 |
| Protein Sequence | Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE |
| UniProt ID | Q6ZW63 |
| MW | 17kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CLDNL, hCG1646163 |
| Research Area | Cell Biology, Infectious Disease & Virology |
| Note | For research use only |
| NCBI | NP_919260 |

Sample Tissue: Human A172 Whole Cell, Antibody dilution: 1 ug/ml.

Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-CLDN23 antibody (orb574767).

WB Suggested Anti-CLDN23 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Cy5.5 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review