You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb575519 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CLCN3 |
| Target | CLCN3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human CLCN3 |
| Protein Sequence | Synthetic peptide located within the following region: VGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVL |
| UniProt ID | P51790 |
| MW | 95kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CLC3, ClC-3 |
| Research Area | Epigenetics |
| Note | For research use only |
| NCBI | NP_776297 |

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Human Brain

WB Suggested Anti-CLCN3 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Human, Porcine | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P, WB | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Human, Porcine | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
HRP |
IF | |
Bovine, Canine, Equine, Gallus, Human, Porcine | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
APC |
IF | |
Bovine, Canine, Equine, Gallus, Human, Porcine | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
FITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review