Clcn1 Rabbit Polyclonal Antibody

• Catalog Number: orb575316
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Clcn1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit
• Reactivity: Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 110kDa
• Target: Clcn1
• UniProt ID: P35524
• Protein Sequence: Synthetic peptide located within the following region: SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV
• NCBI: NP_037279
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SMCC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1: 20 ug mouse muscle membrane fraction, 2: Empty, 3: 20 ug mouse brain membrane fraction, 4: Empty, 5: 20 ug mouse muscle cytosolic fraction, 6: 20 ug mouse brain cytosolic fraction, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: Clcn1.

WB Suggested Anti-Clcn1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Rat Brain.