You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324594 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CLCA2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CLCA2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 104 kDa |
Target | CLCA2 |
UniProt ID | Q9UQC9 |
Protein Sequence | Synthetic peptide located within the following region: RYFFSFAANGRYSLKVHVNHSPSISTPAHSIPGSHAMYVPGYTANGNIQM |
NCBI | NP_006527 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti CACC antibody, anti CACC3 antibody, anti CLCR Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
Sample Tissue: Human ACHN Whole Cell, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-CLCA2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: THP-1 cell lysate.
WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
ICC, IF | |
Canine, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE/Cy5 |