CITED4 Rabbit Polyclonal Antibody

• Catalog Number: orb324685
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CITED4
• Target: CITED4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse CITED4
• Protein Sequence: Synthetic peptide located within the following region: PYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAG
• UniProt ID: Q9WUL8
• MW: 20kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti Mrg2 antibody, anti MRG-2 antibody
• Research Area: Epigenetics & Chromatin, Molecular Biology
• Note: For research use only
• NCBI: NP_062509

WB Suggested Anti-CITED4 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: SP2/0 cell lysate.