You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324685 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CITED4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse CITED4 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 20kDa |
Target | CITED4 |
UniProt ID | Q9WUL8 |
Protein Sequence | Synthetic peptide located within the following region: PYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAG |
NCBI | NP_062509 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti Mrg2 antibody, anti MRG-2 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-CITED4 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: SP2/0 cell lysate.