CHST15 antibody

• Catalog Number: orb325320
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHST15
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GALNAC4S-6ST
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 65 kDa
• Target: CHST15
• UniProt ID: Q7LFX5
• Protein Sequence: Synthetic peptide located within the following region: YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS
• NCBI: NP_056976
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti BRAG antibody, anti DKFZp781H1369 antibody, a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human MCF7 tissue using CHST15 antibody

Western blot analysis of Hela cell lysate tissue using CHST15 antibody

Western blot analysis of human Fetal Lung tissue using CHST15 antibody

Western blot analysis of human Fetal Heart tissue using CHST15 antibody