GALNAC4S-6ST Rabbit Polyclonal Antibody

• Catalog Number: orb325320
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHST15
• Target: CHST15
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GALNAC4S-6ST
• Protein Sequence: Synthetic peptide located within the following region: YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS
• UniProt ID: Q7LFX5
• MW: 65 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti BRAG antibody, anti DKFZp781H1369 antibody, a
• Note: For research use only
• NCBI: NP_056976

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, CHST15 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-GALNAC4S-6ST Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Hela cell lysate.