You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592778 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CHRFAM7A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Mouse |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA7 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56 kDa |
Target | CHRNA7 |
UniProt ID | P36544 |
Protein Sequence | Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV |
NCBI | NP_000737 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NACHRA7, CHRNA7-2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/ml.
Sample Type: MDA-MB-435S Cell lysates, Antibody Dilution: 1.0 ug/ml.
Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-CHRNA7 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Gallus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |