CHRNA3 Rabbit Polyclonal Antibody

• Catalog Number: orb592775
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHRNA3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57kDa
• Target: CHRNA3
• UniProt ID: P32297
• Protein Sequence: Synthetic peptide located within the following region: LPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVD
• NCBI: NP_000734
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LNCR2, PAOD2, BAIPRCK, NACHRA3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-CHRNA3 Antibody Titration: 0.1 ug/ml, Positive Control: Human Thymus.