CHMP1B Rabbit Polyclonal Antibody

• Catalog Number: orb583555
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHMP1B
• Target: CHMP1B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHMP1B
• Protein Sequence: Synthetic peptide located within the following region: KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT
• UniProt ID: Q7LBR1
• MW: 22kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Vps46B, C10orf2, C18orf2, CHMP1.5, Vps46-2, C18-OR
• Note: For research use only
• NCBI: NP_065145

WB Suggested Anti-CHMP1B Antibody Titration: 0.2-1 ug/ml, Positive Control: Human heart.