Cart summary

You have no items in your shopping cart.

CHIA Rabbit Polyclonal Antibody

Catalog Number: orb578537

DispatchUsually dispatched within 3-7 working days
$ 600.00
Catalog Numberorb578537
CategoryAntibodies
DescriptionRabbit polyclonal antibody to CHIA
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish
ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CHIA
Concentration0.5 mg/ml
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ConjugationUnconjugated
MW40kDa
TargetCHIA
UniProt IDQ9BZP6
Protein SequenceSynthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL
NCBINP_068569
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative namesCHIT2, AMCASE, TSA1902
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.
CHIA Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

CHIA Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

CHIA Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

CHIA Rabbit Polyclonal Antibody

WB Suggested Anti-CHIA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.