CHAF1B Rabbit Polyclonal Antibody

• Catalog Number: orb579586
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CHAF1B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHAF1B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61kDa
• Target: CHAF1B
• UniProt ID: Q13112
• Protein Sequence: Synthetic peptide located within the following region: KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD
• NCBI: NP_005432
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CAF1, MPP7, CAF-1, CAF1A, CAF1P60, CAF-IP60, MPHOS
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CHAF1B antibody - N-terminal region (orb579586) validated by WB using Mouse brains at 1:1000.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. CHAF1B is supported by BioGPS gene expression data to be expressed in HEK293T.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. CHAF1B is supported by BioGPS gene expression data to be expressed in HepG2.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. CHAF1B is supported by BioGPS gene expression data to be expressed in Jurkat.

WB Suggested Anti-CHAF1B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Liver.