Cart summary

You have no items in your shopping cart.

CGN Rabbit Polyclonal Antibody (FITC)

CGN Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2121501

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2121501
CategoryAntibodies
DescriptionCGN Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence EGFQKPSASLSQLESQNQLLQERLQAEEREKTVLQSTNRKLERKVKELSI
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW136 kDa
UniProt IDQ9P2M7
Protein SequenceSynthetic peptide located within the following region: EGFQKPSASLSQLESQNQLLQERLQAEEREKTVLQSTNRKLERKVKELSI
NCBINP_065821
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
NoteFor research use only
Expiration Date12 months from date of receipt.
  • CGN Rabbit Polyclonal Antibody (FITC) [orb2121504]

    WB

    Bovine, Equine, Guinea pig, Human, Rabbit, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl