CFP Rabbit Polyclonal Antibody

• Catalog Number: orb583135
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CFP
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CFP
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51 kDa
• Target: CFP
• UniProt ID: P27918
• Protein Sequence: Synthetic peptide located within the following region: QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS
• NCBI: NP_002612
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BFD, PFC, PFD, PROPERDIN
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Immunohistochemistry with Tonsil tissue at an antibody concentration of 5 ug/ml using anti-CFP antibody (orb583135).

WB Suggested Anti-CFP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human brain.