You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330208 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CES1 |
| Target | CES1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CES1 |
| Protein Sequence | Synthetic peptide located within the following region: ANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNL |
| UniProt ID | P23141 |
| MW | 63 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti CEH antibody, anti CES2 antibody, anti HMSE a Read more... |
| Research Area | Disease Biomarkers |
| Note | For research use only |
| NCBI | NP_001020365 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-CES1 Antibody Titration: 1.25 ug/mL, Positive Control: PANC1 cell lysate, CES1 is supported by BioGPS gene expression data to be expressed in PANC1.
FC, IF, IHC-Fr, IHC-P | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Human, Porcine, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review