CES1 Rabbit Polyclonal Antibody

SKU: orb330208

Description

Rabbit polyclonal antibody to CES1

Research Area

Disease Biomarkers

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CES1
• Target: CES1
• Protein Sequence: Synthetic peptide located within the following region: ANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNL
• Molecular Weight: 63 kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CEH antibody, anti CES2 antibody, anti HMSE antibody, anti HMSE1 antibody, anti SES1 antibody, anti REH antibody, anti TGH antibody, anti ACAT antibody, anti PCE-1 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-CES1 Antibody Titration: 1.25 ug/mL, Positive Control: PANC1 cell lysate, CES1 is supported by BioGPS gene expression data to be expressed in PANC1.

Quick Database Links

Gene Symbol

CES1

UniProt

P23141

RefSeq (Protein):NP_001020365