CES1 Rabbit Polyclonal Antibody

SKU: orb330208

Description

CES1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of CES1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human CES1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CES1
• Target: CES1
• Protein Sequence: Synthetic peptide located within the following region: ANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNL
• Molecular Weight: 63 kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CEH antibody, anti CES2 antibody, anti HMSE antibody, anti HMSE1 antibody, anti SES1 antibody, anti REH antibody, anti TGH antibody, anti ACAT antibody, anti PCE-1 antibody

Quick Database Links

Gene Symbol

CES1

UniProt

P23141

RefSeq (Protein):NP_001020365